Home > Product > Antimicrobial Peptides > HFIAP-3

Antimicrobial Peptides

CAT#
AF2047
Sequence
GWFKKAWRKVKNAGRRVLKGVGIHYGVGLIZ
Host Chemicals
Myxine glutinosa
Length
31
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.