Keywords Search Google Search Search

Immune-induced peptide 18

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	I05010
Sequence	SRHTGPGNGSGSGAGSGNPFRSPSSQQRPLYYDAPIGKPSKTMYA

CAT#	Product Name	Inquiry
X16349	PM_9405421	Inquiry
C0075	H-Leu-Ala-Pro-OH	Inquiry
X19057	UP_P55936	Inquiry
X00536	PH1BS005_08	Inquiry
X07227	PM_15652642	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

MC1R antagonist-MSG 606

MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...

The effect of thymopentin in the treatment of chronic severe viral hepatitis B

The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

The medical value of MCL 0020

MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...

Function of peptide YY (3-36) in ingestion behavior

Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: