Home > Product > Antimicrobial Peptides > Ir-Def2

Antimicrobial Peptides

CAT#
AF2584
Sequence
GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
Host Chemicals
Ixodes ricinus
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.