Home > Product > Catalog Peptides > Others > Kelch 3

Others

CAT#
A40004
Sequence
MLVIFGHCPLYGYISNVQEYDLDKNTWSILHTQGALVQGGYGHSSVYD
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.