Home > Product > Catalog Peptides > Others > Leiurotoxin I

Others

Leiurotoxin I

[Price Inquiry]
CAT#
L02001
Sequence
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2
M.W/Mr.
3423.19
Molecular Formula
C142H237N45O39S7
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.