Home > Product > Antimicrobial Peptides > Lichenicidin

Antimicrobial Peptides

Lichenicidin

[Price Inquiry]
CAT#
AF2320
Sequence
TITLSTCAILSKPLGNNGYLCTVTKECMPSSCN
Host Chemicals
Bacillus licheniformis ATCC 14580 or VK21
Length
33
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.