Home > Product > Catalog Peptides > Others > LL-37 pentamide

Others

LL-37 pentamide

[Price Inquiry]
CAT#
L07003
Sequence
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
M.W/Mr.
4522.4
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.