Home > Product > Catalog Peptides > Others > LL-37 pentamide

Others

LL-37 pentamide

Price Inquiry
CAT#
L07003
Sequence
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
M.W/Mr.
4522.4
Length
37

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.