Home > Product > Catalog Peptides > Others > M-zodatoxin-Lt6a

Others

M-zodatoxin-Lt6a

[Price Inquiry]
CAT#
M17008
Sequence
QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.