Home > Product > Catalog Peptides > β-Amyloid (1-42), (1-40), (1-46) and Fragments > [Met]-beta-Amyloid (1-42), mouse, rat

β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Met]-beta-Amyloid (1-42), mouse, rat

Price Inquiry
CAT#
A13312
Sequence
MDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVI
M.W/Mr.
4549.2
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.