Home > Product > Catalog Peptides > Others > Metastin_human

Others

Metastin_human

[Price Inquiry]
CAT#
M13001
Sequence
GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Length
54
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.