Home > Product > Catalog Peptides > Others > Metastin_mouse

Others

Metastin_mouse

[Price Inquiry]
CAT#
M13005
Sequence
SSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRY
Modifications
Phosphotyrosine;Phenylalanine amide
Length
52
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.