Home > Product > Catalog Peptides > Others > Myticin-A

Others

CAT#
M21001
Sequence
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.