Keywords Search Google Search Search

Neuropeptide W-30 (human) trifluoroacetate salt

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	N1945
CAS	383415-80-3
M.F/Formula	C₁₆₅H₂₄₉N₄₉O₃₇S
M.W/Mr.	3543.17
Sequence	One Letter Code: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW three Letter Code: H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp-OH trifluoroacetate salt

CAT#	Product Name	Inquiry
N1902	26Rfa Hypothalamic Peptide rat	Inquiry
N1950	Peptide Lv (rat) trifluoroacetate salt	Inquiry
N1926	Head activator	Inquiry
N1933	H-Tyr-Gln-Ser-Leu-Arg-Trp-NH₂ acetate salt	Inquiry
N1904	26Rfa, Hypothalamic Peptide, frog	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of perindopril erbumine in hypertension

Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Bovine Pancreatic Trypsin Inhibitor (BPTI)-Aprotinin

Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Storage	-20 ± 5 °C