Home > Product > Catalog Peptides > Others > Omega-agatoxin-Aa4a

Others

Omega-agatoxin-Aa4a

[Price Inquiry]
CAT#
A30002
Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Modifications
Disulfide bond(4)
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.