Home > Product > Catalog Peptides > Others > Omega-lycotoxin-Gsp2671f

Others

Omega-lycotoxin-Gsp2671f

[Price Inquiry]
CAT#
L13008
Sequence
EKSCTTWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW
Modifications
Disulfide bond(4)
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.