Home > Product > Antimicrobial Peptides > Ostricacin-3

Antimicrobial Peptides

Ostricacin-3

[Price Inquiry]
CAT#
AF2837
Sequence
IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRR
Host Chemicals
Struthio camelus
Length
40
Activity
Antibacterial
SwissProt ID
P85115
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.