Keywords Search Google Search Search

Ostricacin-3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2837
Sequence	IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRR
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF970	Nigrocin-OG13	Inquiry
AF1626	Ranatuerin-2PLc	Inquiry
AF1458	Caerin-2.1	Inquiry
AF2091	Ranatuerin-3	Inquiry
AF3029	NLP-28	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Function of lepirudin in heparin-induced thrombocytopenia

Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

UFP-101-A Peptide Antagonist Selective for the Nociceptin/Orphanin FQ Receptor

Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Struthio camelus
Length	40
SwissProt ID	P85115