Home > Product > Antimicrobial Peptides > Ostricacin-4

Antimicrobial Peptides

Ostricacin-4

[Price Inquiry]
CAT#
AF2947
Sequence
LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWV
Host Chemicals
Struthio camelus
Length
42
Activity
Antibacterial
SwissProt ID
P85116
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.