Antimicrobial Peptides

CAT#
AF3309
Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Host Chemicals
Penicillium chrysogenum
Length
55
Activity
Fungi,
SwissProt ID
PDB ID: 2KCN
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.