Home > Product > Antimicrobial Peptides > Palustrin-2LTa

Antimicrobial Peptides

Palustrin-2LTa

[Price Inquiry]
CAT#
AF2064
Sequence
SLWENFKNAGKQFILNILDKIRCRVAGGCRT
Host Chemicals
the broad-folded frog, Hylarana latouchii, China, Asia
Length
31
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.