Home > Product > Antimicrobial Peptides > Palustrin-2SIb

Antimicrobial Peptides

Palustrin-2SIb

Price Inquiry
CAT#
AF2500
Sequence
GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE
Host Chemicals
Odorrana ishikawae
Length
36
Activity
Antibacterial, Antifungal

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.