Keywords Search Google Search Search

Palustrin-2SIb

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2500
Sequence	GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1937	Varv peptide B	Inquiry
AF1223	Hcl-hst5	Inquiry
AF826	Maximin-H8	Inquiry
AF767	Kassinatuerin-2Md	Inquiry
AF1597	CPF-SE1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Function of carnosine in skin, food and body

Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Function of dipeptide diaminobutyroyl benzylamide diacetate in skin

Dipeptide diaminobutyroyl benzylamide diacetate, a biologically active polypeptide, classified as a neuropeptide ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Odorrana ishikawae
Length	36