Home > Product > Antimicrobial Peptides > Palustrin-2SIb

Antimicrobial Peptides

Palustrin-2SIb

[Price Inquiry]
CAT#
AF2500
Sequence
GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE
Host Chemicals
Odorrana ishikawae
Length
36
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.