Home > Product > Antimicrobial Peptides > Pandinin-1

Antimicrobial Peptides

Pandinin-1

[Price Inquiry]
CAT#
AF3089
Sequence
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT
Host Chemicals
Pandinus imperator
Length
44
Activity
Antibacterial
SwissProt ID
P83239
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.