Home > Product > Antimicrobial Peptides > Pardaxin Pa4

Antimicrobial Peptides

Pardaxin Pa4

[Price Inquiry]
CAT#
AF2183
Sequence
GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Host Chemicals
Pardachirus marmoratus
Length
33
Activity
Antimicrobial
SwissProt ID
P81861
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.