Parstatin (human)
Online Inquiry
| CAT# | GR2141 |
| CAS | 1065755-99-8 |
| Synonyms/Alias | Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo. |
| M.F/Formula | C191H330N64O53S3 |
| M.W/Mr. | 4467.29 |
| Sequence | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
Write a review
Ask a question
My Review for Parstatin (human)
Required fields are marked with *
×
Ask a Question for Parstatin (human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
