Home > Product > Antimicrobial Peptides > Pediocin PA-1

Antimicrobial Peptides

Pediocin PA-1

[Price Inquiry]
CAT#
AF3097
Sequence
KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC
Host Chemicals
Pediococcus acidilactici PAC1.0
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.