Home > Product > Catalog Peptides > Others > Peptide Histidine Isoleucinamide (PHI), Porcine (1 - 27)

Others

warning All products are for research use only. Not for human use.

Peptide Histidine Isoleucinamide (PHI), Porcine (1 - 27)

[Price Inquiry]
CAT#
G05004
Sequence
HADGVFTSDFSRLLGQLSAKKYLESLI-NH2
M.W/Mr.
2995.4
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.