CAT# | G05005 |
M.W/Mr. | 3011.4 |
Sequence | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
Length | 27 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X00753 | PH1BS017_55 | Inquiry | ||
X04062 | PM_11278668 | Inquiry | ||
X12298 | PM_3546690 | Inquiry | ||
X21135 | YVHNP_Abeta | Inquiry | ||
X07950 | PM_16423834 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...