Keywords Search Google Search Search

Pilosulin 4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2496
Sequence	FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2350	Cecropin-A	Inquiry
AF2264	Brevinin-2-OA8	Inquiry
AF1070	Odorranain-P-RA2 peptide precursor	Inquiry
AF1680	Cationic antimicrobial protein	Inquiry
AF549	Temporin-1CEb	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

Mechanism of Acetyl Tetrapeptide-22

The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...

Function of dipeptide diaminobutyroyl benzylamide diacetate in skin

Dipeptide diaminobutyroyl benzylamide diacetate, a biologically active polypeptide, classified as a neuropeptide ...

Function of Huwentoxin-XVI in analgesia

Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Myrmecia banksi
Length	36
SwissProt ID	Q68Y22