Home > Product > Catalog Peptides > Others > Pilosulin-1 68->112

Others

Pilosulin-1 68->112

[Price Inquiry]
CAT#
P25003
Sequence
ILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
Length
45
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.