Home > Product > Antimicrobial Peptides > Piscidin-like antimicrobial peptide precursor

Antimicrobial Peptides

Piscidin-like antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2909
Sequence
RCIALFLVLSLVVLMAEPGEGFFFHIIKGLFHAGRMIHGLV
Host Chemicals
Epinephelus malabaricus
Length
41
Activity
Antimicrobial
SwissProt ID
F1CNA8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.