Home > Product > Catalog Peptides > Others > Prepro-adrenomedullin (153-185), human

Others

Prepro-adrenomedullin (153-185), human

[Price Inquiry]
CAT#
A05009
Sequence
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
M.W/Mr.
3219.6
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.