Prepro-Atrial Natriuretic Factor (26-55) (human)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A17053
CAS	112160-82-4
M.F/Formula	C₁₅₂H₂₃₆N₃₈O₅₁S₃
M.W/Mr.	3507.97
Sequence	One Letter Code: NPMYNAVSNADLMDFKNLLDHLEEKMPLED three Letter Code: H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH

CAT#	Product Name	Inquiry
A17028	Atrial Natriuretic Peptide (ANP)(1-28) Alpha (Human, Ovine, Canine)	Inquiry
A17026	Atrial Natriuretic Peptide (3-28), human	Inquiry
A17045	Atrial Natriuretic Factor (3-28) (human, bovine, porcine) trifluoroacetate salt	Inquiry
A17009	Anantin	Inquiry
A17013	Atrial Natriuretic Peptide (4-24), frog	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of st-Ht31 in advanced atherosclerotic lesions and cardiovascular disease

st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...

UT receptor peptide antagonist-UFP 803

UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...

The Function of Darifenacin Hydrobromide in over Active Bladder

Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Function of icatibant in hereditary angioedema

Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Length	30
Storage	-20 ± 5 °C