Home > Product > Catalog Peptides > Others > Prosomatostatin (1-32), porcine

Others

warning All products are for research use only. Not for human use.

Prosomatostatin (1-32), porcine

[Price Inquiry]
CAT#
S07007
Sequence
APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL
M.W/Mr.
3532.1
Molecular Formula
C161H260N44O45
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.