Home > Product > Catalog Peptides > Others > PSI 3

Others

warning All products are for research use only. Not for human use.
CAT#
A40010
Sequence
PCALRTACGDCTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSTCP
Length
52
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.