Sermorelin
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues
Online Inquiry
| CAT# | HB00118 |
| Chemical Structure |  |
| CAS | 86168-78-7 |
| Synonyms/Alias | Semorelin;SERMORELIN;Sermorelin Aceta;Sermelin Acetate;SERMORELIN ACETATE;GRF (1-29) AMIDE (HUMAN);GHRF (1-29), AMIDE, HUMAN;Green tea powdered extract;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;GRF (1-29) aMide (huMan) SerMorelin |
| M.F/Formula | C149H246N44O42S |
| M.W/Mr. | 3357.88 |
| Sequence | Three Letter Code: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 |
| Biological Activity | Sermorelin, also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH. |
| Storage | Desiccate at -20°C |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Sermorelin
Required fields are marked with *
×
Ask a Question for Sermorelin
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
