Home > Product > Antimicrobial Peptides > SI Moricin

Antimicrobial Peptides

SI Moricin

[Price Inquiry]
CAT#
AF2937
Sequence
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK
Host Chemicals
Bean golden mosaic virus-[Brazil]
Length
42
Activity
Antibacterial
SwissProt ID
Q7YZB4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.