Home > Product > Antimicrobial Peptides > Sm-AMP-D1

Antimicrobial Peptides

CAT#
AF3264
Sequence
KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFDC
Host Chemicals
seeds, common chickweed, Stellaria media L
Length
50
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.