Home > Product > Antimicrobial Peptides > SpStrongylocin 1

Antimicrobial Peptides

SpStrongylocin 1

[Price Inquiry]
CAT#
AF3246
Sequence
IFNSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPST
Host Chemicals
Strongylocentrotus purpuratus
Length
48
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.