Home > Product > Antimicrobial Peptides > SpStrongylocin 2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

SpStrongylocin 2

[Price Inquiry]
CAT#
AF3298
Sequence
WNPFRKLYRKECNDVTSCDTVSGVKTCTKKNCCHRKFFGKTILKAPECTVIS
Host Chemicals
Strongylocentrotus purpuratus
Length
52
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.