Home > Product > Catalog Peptides > Others > Styelin-E

Others

Styelin-E

Price Inquiry
CAT#
S17005
Sequence
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL
Modifications
Leucine amide;6'-bromotryptophan(2);3,4-dihydroxyarginine(4);4,5-dihydroxylysine;3',4'-dihydroxyphenylalanine;6-hydroxylysine;
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.