Home > Product > Catalog Peptides > Others > Styelin-E

Others

CAT#
S17005
Sequence
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL
Modifications
Leucine amide;6'-bromotryptophan(2);3,4-dihydroxyarginine(4);4,5-dihydroxylysine;3',4'-dihydroxyphenylalanine;6-hydroxylysine;
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.