Home > Product > Catalog Peptides > Others > Tachystatin-A2

Others

Tachystatin-A2

[Price Inquiry]
CAT#
T17001
Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
Modifications
Disulfide bond(3)
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.