Tat-Beclin-1, scrambled

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	GR1215
Sequence	One Letter Code: YGRKKRRQRRRGGVGNDFFINHETTGFATEW Three-Letter Code: Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-His-Phe-Phe-Ile-Asn-His-Ser-Thr-Thr-Gly-Phe-Ala-Thr-Gln-Trp-OH
Purity	% Peak Area By HPLC ≥ 95%

CAT#	Product Name	Inquiry
GR1226	TAT P59W	Inquiry
GR1209	TAT (47-57), FAM-labeled	Inquiry
GR1205	D-TAT (47-57)	Inquiry
GR1206	TAT (48-57)	Inquiry
GR1222	TAT-NSF222scr Fusion Polypeptide, scrambled	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Size	1 mg
Storage	-20°C
References	Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012).