Keywords Search Google Search Search

THP-1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2417
Sequence	GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF3222	White cloud bean defensin	Inquiry
AF623	Temporin-1Sd precursor, partial	Inquiry
AF3010	Sakacin 5X	Inquiry
AF2793	Moricin-like peptide A	Inquiry
AF1112	Magainin-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Jingzhaotoxin-III, A Selective NaV1.5 Channel Blocker

Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Function of dynorphin A (1-13) in ischemic brain injury

Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Inhibition of mast cell tryptase by APC 366

APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Meleagris gallopavo
Length	35
SwissProt ID	P80391