Home > Product > Catalog Peptides > Others > Toll-Like Receptor 5 (TLR5), human

Others

warning All products are for research use only. Not for human use.

Toll-Like Receptor 5 (TLR5), human

[Price Inquiry]
CAT#
M07051
Sequence
DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.