Home > Product > Catalog Peptides > Others > [Tyr0] Calcitonin Gene Related Peptide, rat

Others

[Tyr0] Calcitonin Gene Related Peptide, rat

Price Inquiry
CAT#
C05019
Sequence
YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2
M.W/Mr.
3970.0
Molecular Formula
C171H271N51O54S2
Length
38

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.