Home > Product > Catalog Peptides > Others > [Tyr0] Calcitonin Gene Related Peptide, rat

Others

[Tyr0] Calcitonin Gene Related Peptide, rat

[Price Inquiry]
CAT#
C05019
Sequence
YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2
M.W/Mr.
3970.0
Molecular Formula
C171H271N51O54S2
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.