Home > Product > Catalog Peptides > Others > (Tyr0)-Urocortin, rat

Others

(Tyr0)-Urocortin, rat

[Price Inquiry]
CAT#
U02008
Sequence
YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2
M.W/Mr.
4870.5
Molecular Formula
C215H347N63O66
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.