CAT# | U02008 |
M.F/Formula | C215H347N63O66 |
M.W/Mr. | 4870.5 |
Sequence | YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
Length | 41 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X00126 | CRSTR_MpcII-3 | Inquiry | ||
X12018 | PM_3098288 | Inquiry | ||
X08047 | PM_16490281 | Inquiry | ||
X06692 | PM_15110848 | Inquiry | ||
X03303 | PM_10773584 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...