Home > Product > Catalog Peptides > Others > U1-sicaritoxin-Li1b

Others

warning All products are for research use only. Not for human use.

U1-sicaritoxin-Li1b

[Price Inquiry]
CAT#
S14002
Sequence
ACKGEGVKGCYYEADDWCCKKTPCKCPAWSHERECRCTQPCNPSCR
Modifications
Arginine amide;Disulfide bond(4);
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.