Home > Product > Catalog Peptides > Others > U2-hexatoxin-Hi1a

Others

U2-hexatoxin-Hi1a

[Price Inquiry]
CAT#
H18001
Sequence
KCLAEAADCSPWSGDSCCKPYLCSCIFFYPCSCRPKGW
Modifications
Disulfide bond(4)
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.