Keywords Search Google Search Search

U2-hexatoxin-Hi1a

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	H18001
Sequence	KCLAEAADCSPWSGDSCCKPYLCSCIFFYPCSCRPKGW

CAT#	Product Name	Inquiry
X16306	PM_9377571	Inquiry
X10871	PM_2168396	Inquiry
P25004	Pilosulin-1 71->112	Inquiry
X05278	PM_12466246	Inquiry
Q0101	rec GRO/Melanoma Growth Stimulating Activity (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

A new kind of glycopeptide antibiotics–Ramoplanin

Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...

Function of peptide YY (3-36) in ingestion behavior

Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...

Glucagon-like peptide-1 (7-36) amide

The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	38
Modifications	Disulfide bond(4)