Home > Product > Catalog Peptides > Others > UPAR/Ly6

Others

CAT#
S15013
Sequence
KCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSC
Modifications
Disulfide bond(3)
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.