Home > Product > Catalog Peptides > Others > Urocortin III, mouse

Others

Urocortin III, mouse

[Price Inquiry]
CAT#
U02007
Sequence
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
M.W/Mr.
4172.97
Molecular Formula
C186H312N52O52S2
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.