Keywords Search Google Search Search

Urocortin III, mouse

Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1739
CAS	357952-10-4
M.F/Formula	C₁₈₆H₃₁₂N₅₂O₅₂S₂
M.W/Mr.	4172.97
Sequence	One Letter Code: FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 three Letter Code: Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2

CAT#	Product Name	Inquiry
R1855	Cibinetide	Inquiry
R1882	RF 9	Inquiry
R1247	Bradykinin 1-5	Inquiry
R1349	Fibrinogen Binding Inhibitor Peptide	Inquiry
R2078	Binetrakin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Psalmotoxin 1 in against pain

Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...

Function of dipeptide diaminobutyroyl benzylamide diacetate in skin

Dipeptide diaminobutyroyl benzylamide diacetate, a biologically active polypeptide, classified as a neuropeptide ...

GR 64349, A Selective and Potent NK2 Agonist

GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: