Home > Product > Catalog Peptides > Others > Urodilatin (95-126)

Others

Urodilatin (95-126)

Price Inquiry
CAT#
A17032
Sequence
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
M.W/Mr.
3506.0
Molecular Formula
C145H234N52O44S3
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.