Home > Product > Catalog Peptides > Others > Urodilatin (95-126)

Others

warning All products are for research use only. Not for human use.

Urodilatin (95-126)

[Price Inquiry]
CAT#
A17032
Sequence
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
M.W/Mr.
3506.0
Molecular Formula
C145H234N52O44S3
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.